LOCUS       HPVVS208L1    386 bp    DNA             VRL       30-APR-1996
DEFINITION  Human papillomavirus DNA for capsid protein L1 gene (clone
            vs208-1).
ACCESSION   X89885
NID         g1296537
KEYWORDS    capsid protein L1.
SOURCE      Human papillomavirus.
  ORGANISM  Human papillomavirus
            Viruses; dsDNA viruses, no RNA stage; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 386)
  AUTHORS   Shamanin,V., Zur Hausen,H., Lavergne,D., Proby,C., Leigh,I.,
            Neumann,C., Hamm,H., Goos,M., Haustein,U.F., Jung,E., Plewig,G.,
            Wolff,H. and de Villiers,E.M.
  TITLE     HPV infections in non-melanoma skin cancers from renal transplant
            recipients and non-immunosuppressed patients
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 386)
  AUTHORS   Shamanin,V.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-1995) V.A. Shamanin, Deutsches
            Krebsforschungszentrum, Im Neuenheimer Feld 242, D- 69120
            Heidelberg, FRG
  REMARK    Revised by [3]
REFERENCE   3  (bases 1 to 386)
  AUTHORS   Shamanin,V.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-APR-1996) V.A. Shamanin, Deutsches
            Krebsforschungszentrum, Im Neuenheimer Feld 242, D- 69120
            Heidelberg, FRG
COMMENT
            NCBI gi: 1296537
FEATURES               Location/Qualifiers
     source          1..386
                     /organism="Human papillomavirus"
                     /isolate="vs208-1"
     CDS             <1..>386
                     /gene="L1 ORF"
                     /note="NCBI gi: 1296538"
                     /codon_start=1
                     /product="capsid protein L1"
                     /db_xref="PID:g1296538"
                     /translation="LEDGEMIDTGYGAMDFRTLQETKSEVPLDICQSVCKYPDYLQMS
                     ADVYGDSMFFCLRKEQLFARHFWNRGGMVGDTIPSELYIKGTDIRERPGTHVYSPSPS
                     GSMVSSDSQLFNKPYWLHKAQGHNNG"
BASE COUNT      100 a     73 c     97 g    116 t
ORIGIN      
        1 cttgaggatg gggaaatgat agatacaggc tatggtgcca tggactttcg tacattgcag
       61 gaaaccaaaa gtgaggtacc actagatatt tgccaatccg tgtgtaaata tcctgattat
      121 ttgcagatgt ctgctgatgt atatggggac agtatgtttt tttgtttgcg caaggaacag
      181 ttgtttgcca ggcacttttg gaatagaggt ggcatggtgg gcgacacaat accttcagag
      241 ttatatatta aaggcacgga tatacgtgag cgtcctggta ctcatgtata ttccccttcc
      301 ccaagtggct ctatggtctc ttctgattcc cagttgttta ataagcccta ttggttgcat
      361 aaggcccaag gccacaataa cgggat