LOCUS HPVVS19L1 407 bp DNA VRL 30-APR-1996 DEFINITION Human papillomavirus DNA for capsid protein L1 gene (clone vs19-6). ACCESSION X89876 NID g1296535 KEYWORDS capsid protein L1. SOURCE Human papillomavirus. ORGANISM Human papillomavirus Viruses; dsDNA viruses, no RNA stage; Papovaviridae; Papillomavirus. REFERENCE 1 (bases 1 to 407) AUTHORS Shamanin,V., Zur Hausen,H., Lavergne,D., Proby,C., Leigh,I., Neumann,C., Hamm,H., Goos,M., Haustein,U.F., Jung,E., Plewig,G., Wolff,H. and de Villiers,E.M. TITLE HPV infections in non-melanoma skin cancers from renal transplant recipients and non-immunosuppressed patients JOURNAL Unpublished REFERENCE 2 (bases 1 to 407) AUTHORS Shamanin,V.A. TITLE Direct Submission JOURNAL Submitted (21-JUL-1995) V.A. Shamanin, Deutsches Krebsforschungszentrum, Im Neuenheimer Feld 242, D- 69120 Heidelberg, FRG REMARK Revised by [3] REFERENCE 3 (bases 1 to 407) AUTHORS Shamanin,V.A. TITLE Direct Submission JOURNAL Submitted (30-APR-1996) V.A. Shamanin, Deutsches Krebsforschungszentrum, Im Neuenheimer Feld 242, D- 69120 Heidelberg, FRG COMMENT The partial sequence of clone vs19-6 suggests that it constitutes a previously unidentified HPV type. Its sequence is most similar to that of HPV65, making it a new member of group B2. It was isolated from a carcinoma in situ and a squamous cell carcinoma on the hands of an immuno- suppressed patient as part of a study of non-melanoma carcinomas of the skin. The study included samples from 20 squamous cell carcinomas (SCC), 5 basal cell carcinomas (BCC) from 4 RARs, and 4 carcinomas in situ (CIS) from 11, 4, and 4 renal allograft recipients (RARs) respectively, as well as an additional 26 SCC, 11 BCC, and 4 karatoakanthoma from 19, 4, and 4 nonimmunosuppressed patients. Specimens were subjected to degenerate primer PCR as well as PCR with several less degenerate sets of primers. The more degenerate primer system led to the isolation of HPV DNA from many of the RAR samples (8/20 SCC, 1/4 CIS); the remaining samples gave faint signals or none at all. The less degenerate primers led to the isolation of HPV DNA in an additional 5 SCC samples (for a total of 13/20), 3 BCCs (for 3/5), and an additional 2 CIS (3/4). Faint signals were found in the remaining 7 SCCs and 2 BCCs, reflecting either very weak amplification of distantly related HPVs or non-specific amplification of cellular sequences. The less-degenerate primer systems also led to isolation of HPV DNA in 8/25 SCCs and 4/11 BCCs taken from the nonimmunosuppressed patients, with an additional 8 SCCs yielding an unidentified DNA which hybridizes with HPV DNA. The prevalence and quantity of HPV DNA, as well as the types of isolated HPV DNA, differed between RAR and immunocompetent patients. NCBI gi: 1296535 FEATURES Location/Qualifiers source 1..407 /organism="Human papillomavirus" /isolate="vs19-6" CDS <1..>407 /gene="L1 ORF" /note="NCBI gi: 1296536" /codon_start=1 /product="capsid protein L1" /db_xref="PID:g1296536" /translation="MQDGDMCDIGFGACNFRAFQQDRSGVPLDIVDSTCKYPDFLKMT KDKYGDECFFFGRREQLYARHYFTRAGTIGDSIPTPYQESEFYRSPQDSQAQNNVDSH IYVATPSGSLTSSDAQLFNRPYWLQNAQGTNNG" BASE COUNT 120 a 73 c 92 g 122 t ORIGIN 1 atgcaggatg gtgacatgtg tgatatagga ttcggagctt gcaatttcag ggcatttcag 61 caagataggt caggtgttcc tttagatata gtagatagta cttgcaagta tccagacttt 121 ttgaaaatga caaaagacaa gtatggtgat gaatgcttct tttttggtcg tcgagagcag 181 ttgtatgcaa ggcattattt taccagagca ggcacaatag gtgattctat tccaacgcca 241 tatcaggaat ctgaatttta cagatctcca caggatagcc aggctcagaa taatgtggat 301 tctcacattt atgtagccac tcctagtggt tctttaacta gcagtgatgc tcagctgttt 361 aacagacctt attggctcca aaatgctcaa ggtaccaata acggaat