LOCUS       HPVMM9        458 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus isolate MM9, partial L1 cds, My09/My11
            region.
ACCESSION   U12491
SOURCE      Human papillomavirus DNA recovered from a gential swab sample, isolate   
            MM9 (PAP238a).
  ORGANISM  Human papillomavirus
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 458)
  AUTHORS   Manos,M.M., Waldman,J., Zhang,T. Greer,C., Eichinger,G., 
            Schiffmann,M., and Wheeler, C.
  TITLE     Epidemiology and partial nucleotide sequence of four novel genital
            human papillomaviruses
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     MM9, also known as PAP238a, was isolated from a genital swab sample.
            Samples were obtained from over 500 patients examined at either the
            Shasta/Diablo planned parenthood clinic or at a private practice
            in the state of California over the course of seventeen months.
            Each of the samples were cervical or vulvar/intraoital in origin.
            DNA was PCR amplified over the MY09/MY11 region and subsequently
            sequenced if the HPV digested products yielded unique RFLP patterns.
            This procedure resulted in the identification of four novel HPV
            types: W13B, PAP291, PAP155, and PAP238a, which have subsequently
            been renamed MM4, MM7, MM8, and MM9. Oligonucleotide probes over
            the MY9/MY11 region from these viruses have been reported by
            Hildesheim et al. (J Infect Dis 169: 235-40).   These probes were
            used to determine prevalence in different populations.  Prevalence
            for each of these viruses was similar to that seen in other
            characterized "intermediate risk" viruses probed for in these
            studies. In addition to anogenital sites, MM9 was identified in a
            periungual carcinoma with multiply infected digits.  It should be 
            noted that MM4 is extremely similar (90.8%) to novel HPVIS39 (U12481) 
            and MM7 is virtually identical to LVX82 (U12487).  Primer regions are 
            annotated in the sequence; information in this region is not accurate 
            due to primer degeneracy.
            
             
FEATURES             Location/Qualifiers
     CDS             <1..>458
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWHNQLFLTVVDTTRSTNFSVCVGTQASSSTTTYAN
                     SNFKEYLRHAEEFDLQFVLQLCKISLTTEVMTYIHSMNSTILEEWNFGLTPPPSGTLE
                     ETYRYVTSHAISCQRPQPPKETEDPYAKLSFWDVDLKEKFSAELDQYPLG"
BASE COUNT      145 a     79 c     84 g    150 t
ORIGIN      
        1 gcacagggtc ataataatgg tatttgttgg cataatcaat tatttttaac tgttgtagat
       61 actactagaa gcactaattt ttctgtatgt gtaggtacac aggctagtag ctctactaca
      121 acgtatgcca actctaattt taaggaatat ttaagacatg cagaagagtt tgatttacag
      181 tttgttcttc agttatgtaa aattagttta actactgagg taatgacata tatacattct
      241 atgaattcta ctatattgga agagtggaat tttggtctta ccccaccacc gtcaggtact
      301 ttagaggaaa catatagata tgtaacatca catgctatta gttgccaacg tcctcaacct
      361 cctaaagaaa cagaggaccc atatgccaag ctatcctttt gggatgtaga tcttaaggaa
      421 aagttttctg cagaattaga tcagtatccc cttggacg