LOCUS       HPVLVX82      452 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus, isolate LVX82, partial L1 cds, My09/My11
            region.
ACCESSION   U12487
SOURCE      Human papillomavirus, isolate LVX82 from cervical smear.
  ORGANISM  Human papillomavirus
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 452)
  AUTHORS   Ong,C.-K., Bernard,H.-U. and Villa,L.L.
  TITLE     Identification of genomic sequences of three novel human
            papillomaviruses in cervical smears of Amazonian Indians
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPVLVX82, HPVLVX100 and HPVLVX160 were found in cervical smears
            taken from members of isolated Amazonian tribes. The samples were
            PCR-amplified using the MY09/My11 consensus primers, then examined
            in hybridization experiments in order to determine their homology
            with known HPV types. In addition to many previously characterized
            HPV types, these three novel variants were discovered to be more
            than 10% divergent from their closest known relatives, suggesting
            that they may qualify to be considered new types. Although the
            tribes were thought to have been sexually isolated from
            non-Amerindian populations for at least 12,000 years, sequences
            closely related to these novel variants have since been detected in
            other distinct populations.  The authors of [1] state that this may
            be evidence for the hypothesis that papillomavirus types evolved
            before the speciation of Homo sapiens, and consequently before the
            divergence of ethnic groups.  Primer regions are annotated in the
            sequence; information in this region is not accurate due to primer
            degeneracy.  All similarity calculations exclude data from this
            region.

FEATURES             Location/Qualifiers
     CDS             <1..>452
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWFNELFVTVVDTTRSTNITISAAATQANEYTASNF
                     KEYLRHTEEYDLQVILQLCKIHLTPEIMAYLHSMNEHLLDEWNFGVLPPPSTSLDDTY
                     RYLQSRAITCQKGPSAPAPKKDPYDGLVFWEVDLKDKLSTDLDQFPLG"
BASE COUNT      123 a    104 c     87 g    138 t
ORIGIN      
        1 gcccagggtc ataataatgg catttgttgg tttaatgagt tatttgttac agttgtagat
       61 actacccgca gtaccaatat tactatttca gctgctgcta cacaggctaa tgaatacaca
      121 gcctctaact ttaaggaata cctccgccac accgaggaat atgacttaca ggttatattg
      181 caactttgca aaatacatct tacccctgaa attatggcat acctacatag tatgaatgaa
      241 catttattgg atgagtggaa ttttggcgtg ttaccgcctc cctccaccag ccttgatgat
      301 acctatcgct atttgcagtc ccgtgctatt acctgccaaa agggtccttc cgcccctgcc
      361 cctaaaaagg atccttatga tggccttgta ttttgggagg ttgatttaaa ggacaaacta
      421 tccacagatt tagatcagtt tcctttggga cg