LOCUS       HPVLVX160     455 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus, isolate LVX160, partial L1 cds, My09/My11
            region.
ACCESSION   U12486
SOURCE      Human papillomavirus, isolate LVX160, from cervical smear.
  ORGANISM  Human papillomavirus
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 455)
  AUTHORS   Ong,C.-K., Bernard,H.-U. and Villa,L.L.
  TITLE     Identification of genomic sequences of three novel human
            papillomaviruses in cervical smears of Amazonian Indians
  JOURNAL   J. Infect. Dis.  (1994) In press
  STANDARD  full staff_review
COMMENT     HPVLVX82, HPVLVX100 and HPVLVX160 were found in cervical smears
            taken from members of isolated Amazonian tribes. The samples were
            PCR-amplified using the MY09/My11 consensus primers, then examined
            in hybridization experiments in order to determine their homology
            with known HPV types. Each of these three novel variants were more
            than 10% divergent from their closest known relatives, suggesting
            that they may qualify to be considered new types. Although the
            tribes were thought to have been sexually isolated from
            non-Amerindian populations for at least 12,000 years, sequences
            closely related to these novel variants have since been detected in
            other distinct populations.  Ong et al. believe this may be 
            evidence for the hypothesis that papillomavirus types evolved
            before the speciation of Homo sapiens, and consequently before the
            divergence of ethnic groups. LVX160 is virtually identical to
            HPVL1AE1 (U01535) and to HPVCP141 (U12476).  Primer regions are
            annotated in the sequence; information in this region is not
            accurate due to primer degeneracy.  All similarity calculations
            exclude data from this region.

FEATURES             Location/Qualifiers
     CDS             <1..>455
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWHNQLFITVVDTTRSTNFTLSACTETAIPAVYSPT
                     KFKEYTRHVEEYDLQFIFQLCTITLTADVMAYIHTMNPAILDNWNIGVTPPPSASLVD
                     TYRYLQSAAIACQKDAPTPEKKDPYDDLKFWNVDLKEKFSTELDQFPLG"
BASE COUNT      142 a     86 c     90 g    137 t
ORIGIN      
        1 gcacagggtc ataataatgg catttgttgg cataaccagt tgtttattac tgtggtggac
       61 actacacgta gtactaattt tacattgtct gcctgcaccg aaacggccat acctgctgta
      121 tatagcccta caaagtttaa ggaatatact aggcatgtgg aggaatatga tttacaattt
      181 atatttcaat tgtgtactat cacattaact gcagacgtta tggcctacat ccatactatg
      241 aatcctgcaa ttttggacaa ttggaatata ggagttaccc ctccaccatc tgcaagcttg
      301 gtggacacgt ataggtattt acaatcagca gctatagcat gtcaaaagga tgctcctaca
      361 cctgaaaaaa aggatcccta tgacgattta aaattttgga atgttgattt aaaggaaaag
      421 tttagtacag aactagatca gtttcctctg ggacg