LOCUS       HPVL1AE2      415 bp    DNA             VRL       25-MAY-1994
DEFINITION  Human papillomavirus, partial L1 cds, MY09/MY11 region.
ACCESSION   U01532
SOURCE      Human papillomavirus DNA, PCR amplified clone AE2
  ORGANISM  Human papillomavirus
            Viridae; Viruses; Papovaviridae; Papillomavirus.
REFERENCE   1  (bases 1 to 415)
  AUTHORS   Tachezy,R., Van Ranst,M.A., Cruz,Y. and Burk,R.D.
  TITLE     Consensus primer mediated PCR allows identification of novel human
            papillomavirus PCR-types in cervicovaginal lavages
  JOURNAL   Unpublished
  STANDARD  full staff_review
REFERENCE   2  (bases 1 to 415)
  AUTHORS   Van Ranst,M.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-1993) Marc A. Van Ranst, Albert Einstein College
            of Medicine, Dept. of Microbiology & Immunology, 1300 Morris Park
            Avenue, Bronx, NY 10461, USA
  STANDARD  full staff_review
COMMENT     Isolate AE2 is a novel HPV type identified in a study conducted to
            screen cervical lavages from over 500 women for novel HPV types.
            All women involved in the study were seen by physicians from clinics
            or private practices in the Bronx, N.Y. area.  Derived sequences are
            PCR products amplified over the My09/My11 primer region of L1. The
            sequence for AE2 is very close to that of HPVIS039 (U12481).

FEATURES               Location/Qualifiers
     CDS             <1..>415
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=2
                     /translation="ICWNNQLFITCVDTTRSTNLTISTAATPSVAQTFTPTNFKQYIR
                     HGEEYELQFIFQLCKITLTTEVMAYLHTMDSTILEQWNFGLTLPPSASLEDAYRFVKN
                     AATSCQRDSPPQAKQDPLAKYKFWTVDLKERFSLDL"
     source          1..415
                     /organism="human papillomavirus"
                     /specific_host="human"
                     /note="HPV PCR type AE2 as amplified with MY09 and MY11
                     primers"
BASE COUNT      125 a     87 c     76 g    127 t
ORIGIN      
        1 catttgctgg aataatcagc tttttattac ttgtgttgac actaccagaa gtactaattt
       61 aaccattagc actgctgcta ctccatcagt tgcacagaca ttcactccaa caaactttaa
      121 gcagtatatt aggcacgggg aagaatatga attacaattt atttttcaat tgtgtaaaat
      181 tactctaaca actgaggtaa tggcttacct gcacaccatg gattctacaa tactagagca
      241 gtggaatttt ggattaacat tgcctccttc agctagtttg gaggatgcct atcgctttgt
      301 gaaaaatgca gcaacctctt gtcaacggga cagccctcca caggctaaac aggacccttt
      361 ggcaaaatat aagttttgga ccgtggacct taaggaacgc ttttctttag attta