LOCUS HPVCP8304 452 bp ds-DNA VRL 16-OCT-1994 DEFINITION Human papillomavirus, isolate CP8304, partial L1 cds, My09/My11 region. ACCESSION U12480 SOURCE Human papillomavirus, isolate CP8304. ORGANISM Human papillomavirus Viridae; ds-DNA nonenveloped viruses; Papovaviridae; Papillomavirus. REFERENCE 1 (bases 1 to 452) AUTHORS Peyton,C.L. and Wheeler,C.M. TITLE Identification of five novel human papillomaviruses in the New Mexico triethnic population JOURNAL J. Infect. Dis. (1994) In press STANDARD full staff_review COMMENT Data kindly provided prior to publication by Dr. C. Wheeler, University of New Mexico, School of Medicine, New Mexico Tumor Registry, 900 Camino del Salad NE, Albuquerque, NM, 87131-5306. Five novel HPV sequences were identified in a study in which 3655 cervical specimens were screened against known genital HPV DNA [1]. The specimens were obtained from clinical investigations conducted at the University of New Mexico. The study subjects included Native Indians, Hispanics, and non-Hispanic whites. The viral DNA was PCR amplified using the L1 consensus primer MY09/MY11 pair, which can hybridize to a broad spectrum of HPV types. Resultant fragments range from 449 to 458 nucleotides in length. The amplification products were initially screened against 2 sets of type-specific probes and a generic probe. If hybridization to the generic probe and not to the type-specific probes ocurred, the samples were further analyzed by restriction fragment length polymorphisms. RFLP patterns which did not match reference patterns were considered to be derived from novel HPVs. The five novel samples which were were identified in this study include CP8304, CP6108, CP8061, CP141, CP4173. Peyton et al. also identified two HPV45 subtypes and one HPV56 subtype. They conclude that since the existence of subtypes appears to be relatively rare, it suggests that HPV45 and HPV56 are more divergent than many HPV types. It should be noted that CP141 (U12476) is almost identical to LVX160 (U12486) and HPVL1AE1 (U01535) and that CP4173 (U12477) is almost identical to LVX100 (U12485). Both LVX160 and LVX100 were identified by Ong et al. in a 1994 study which examined Amazonian Indian subjects (Ong et al., J. Infect. Dis., 1994, in press). Primer regions are annotated in the sequence; information in this region is not accurate due to primer degeneracy. In a subsequent study Bernard et al. evaluated ten novel genital HPV types, including the five identified in the Peyton et al. study, and other known genital types to determine phylogenetic relationships. They observed that the genital types CP6108, CP8304, CP4173 and CP8061 form a branch with HPV types 61 and 62. This emergent minor branch is positioned between two others which contain cutaneous types. Bernard et al. speculate as to whether other low-risk genital types have escaped detection because of considerable sequence divergence from the common genital types (Bernard et al., J. Infect. Dis., 1994, in press). Bernard et al. also assessed the linear correlation coefficients for the MY9/MY11 fragments against the rest of L1 (.851) and against the E6 gene (.888). Since these values are close, the authors suggest that the evolutionary distance information obtained for the primer pair region should be comparable to that available from the other regions of the genome (Bernard et al., J. Infect. Dis., 1994, in press). FEATURES Location/Qualifiers CDS <1..>452 /note="putative" /product="major capsid protein" /gene="L1" /note="putative" /codon_start=1 /translation="AQGHNNGICWFNEMFVTVVDTTRSTNFTICTATSAAAEYKASNF KEFLRHTEEYDLQFIFQLCKIQLTPEIMAYLHNMNKALLDDWNFGVLPPPSTSLDDTY RFLQSRAITCQKGAAAPAPKEDPYADMSFWTVDLKDKLSTDLDQYPLG" BASE COUNT 125 a 93 c 95 g 139 t ORIGIN 1 gcacagggac ataataatgg tatttgttgg tttaatgaaa tgtttgttac agtggtggat 61 actaccagaa gcaccaattt tactatttgc acagctacat ctgctgctgc agaatacaag 121 gcctctaact ttaaggaatt tctgcgccat acagaggaat atgatttgca gtttattttc 181 caattatgta aaatacagtt aacaccagaa attatggcct acttacataa tatgaacaag 241 gcactgttgg atgattggaa ttttggtgtg ttgccacctc cttccaccag tttagatgac 301 acatatcgct ttttacagtc tcgggccatt acctgtcaaa agggtgctgc tgcccctgcg 361 cccaaagagg acccttatgc cgacatgtca ttttggacag ttgaccttaa ggacaagttg 421 tctactgatt tggatcagta tcctctggga cg