LOCUS       HPV77L1     647 bp    DNA             VRL       15-NOV-1994
DEFINITION  Human Papillomavirus type 77 DNA, part of L1 ORF.
ACCESSION   X79947
KEYWORDS    capsid protein; L1 gene.
SOURCE      Human papillomavirus.
  ORGANISM  Human papillomavirus
            Viruses; dsDNA viruses, no RNA stage; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 647)
  AUTHORS   Shamanin,V.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUN-1994) to the EMBL/GenBank/DDBJ databases. V.A.
            Shamanin, Deutsches Krebsforschungszentrum, Im Neuenheimre Feld
            242, 69120 Heidelberg, FRG
REFERENCE   2  (bases 1 to 647)
  AUTHORS   Shamanin,V., Glover,M., Rausch,C., Proby,C., Leigh,I.M., zur
            Hause,H. and Villiers,E.M.
  JOURNAL   Unpublished
COMMENT     HPV77 (VS93) was isolated from a squaemous cell carcinoma biopsy   
            of a renal allograft patient, and appears likely to constitute
            a new type.  It was found in a search for HPV DNA in 118 skin
            lesions taken from 46 renal allograft patients [1].  The same
            sequence was obtained from lesions from three or more
            patients.  HPV29 appears to be the most closely related known
            type.
            NCBI gi: 562322
FEATURES             Location/Qualifiers
     source          1..647
                     /organism="Human papillomavirus"
                     /isolate="vs93-1"
                     /tissue_type="squaemous cell carcinoma biopsy 72-3-F"
                     /clone="vs93-1"
     CDS             <1..>647
                     /gene="L1"
                     /note="NCBI gi: 562323"
                     /codon_start=1
                     /product="capsid protein L1"
                     /translation="GRGQPLGVGLSGHPLYNKLNDTENSNIAHADNSPDSRDNISVDC
                     KQTQLCILGCTPPMGEYWGKGTPCARTNTTPGDCPPLELMTSYIQDGDMVDTGYGAMD
                     FTALQFNKSDVPLDICQSICKYPDYLGMAADPYGDSMFFFLRREQLFARHFFNRAGDV
                     GDKIPESLYLKGSSGRETPGSAIYSPTPSGSMVTSEAQIFNKSYWLQQAQGQNNG"
BASE COUNT      167 a    157 c    157 g    166 t
ORIGIN      
        1 ggtagaggac agccattagg cgtggggtta agtggacacc ctctgtataa caaactgaat
       61 gacactgaaa actccaacat tgcacatgct gacaatagtc ctgactcccg ggacaacatt
      121 tctgttgact gtaagcaaac acaactgtgc atactgggct gtacgccccc catgggggaa
      181 tactggggta agggtacccc ttgtgcacgt actaatacta ccccaggaga ctgtcctccc
      241 ttggagttaa tgacatctta tattcaggat ggcgacatgg tggataccgg gtatggtgcc
      301 atggacttta ctgccctgca atttaataag tctgacgtgc cccttgatat ttgccagtct
      361 atttgcaaat atcccgatta tttgggcatg gctgccgacc cgtatggcga tagcatgttc
      421 tttttcctcc gtcgggaaca actgtttgcc agacactttt tcaatcgtgc gggtgatgtt
      481 ggagacaaaa ttccagaatc tttgtacctc aaagggagta gcgggcgtga gactcccggc
      541 agtgctatat acagccccac acccagtggg tctatggtga cctctgaggc acaaatattc
      601 aataagtctt actggctaca gcaagctcaa ggccaaaata acggtat