LOCUS       HPV69MY911    455 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 69 (HPV-69), partial L1 cds, My09/My11 
            region.
ACCESSION   U12497
SOURCE      Human papillomavirus type 69 DNA.
  ORGANISM  Human papillomavirus type 69
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 455)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     This HPV-69 partial genomic fragment was isolated by J. Brandsma, 
            C. Greer and M. Manos from a dysplastic lesion of the tongue.  It 
            was designated "JB10" and was later discovered that the sequence 
            was virtually identical to the sequence of HPV-69.  Primer regions 
            are annotated in the sequence; information in this region is not 
            accurate due to primer degeneracy.

FEATURES             Location/Qualifiers
     CDS             <1..>455
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWGNQLFVTCVDTTRSTNLTISTVSAQSASATFKPS
                     DYKQFIRHGEEYELQFIFQLCKITLTTDVMAYIHTMNSAILENWNFGLTLPPTASLED
                     AYRFIKNSATTCQRDAPAQPKEDPFSKLKFWDVDLKEKFSIDLDQYPLG"
BASE COUNT      136 a     87 c     83 g    149 t
ORIGIN      
        1 gcacagggac ataacaatgg catttgttgg ggcaaccaat tgtttgttac ttgtgtagat
       61 actacccgca gtaccaacct cactattagt actgtatctg cacaatctgc atctgccact
      121 tttaaaccat cagattataa gcagtttata aggcatggtg aggaatatga attacagttt
      181 atatttcaat tgtgtaaaat tactcttacc actgatgtaa tggcctatat ccatacaatg
      241 aattctgcta ttttggaaaa ttggaatttt ggccttacct tgcctcctac tgctagtttg
      301 gaagatgcat ataggtttat taaaaattca gctactacat gtcaacgcga tgcccctgca
      361 cagcccaagg aggatccatt tagtaaatta aaattttggg acgttgatct taaagaaaag
      421 ttttctattg atttagatca gtatcccctt ggacg