LOCUS       HPV64MY911    458 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 64 (HPV-64), partial L1 cds, My09/My11
            region.
ACCESSION   U12495
SOURCE      Human papillomavirus type 64 DNA recovered from a patient with
            vulvar intraepithelial neoplasia (VaIN).
  ORGANISM  Human papillomavirus type 64
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 458)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPV-64 has recently been characterized and isolated from a vulvar
            intraepithelial neoplasia by Dr. T. Matsukura.  The cloned DNA 
            was subsequently sequenced by Dr. H. Delius over the L1 MY09/MY11
            segment.  HPV-64 and the several other types recently sequenced 
            over this region by Dr. Delius were used as type-specific probes
            to screen DNA for novel genital HPV types.  The screened DNA was
            obtained from four recent epidemiological studies.  Primer regions
            are annotated in the sequence; information in this region is not
            accurate due to primer degeneracy.

FEATURES             Location/Qualifiers
     CDS             <1..>458
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWHNQLFLTVVYTTRSTNFSVCVGTQSTSTNPPYAN
                     TNFKEYLRHAEEYDLEFVFQLCKITLTTDVMTYIHSMSSSILEQWNFGLTPPPSGTLE
                     ETYRYVTSQAITCQRPQPPKESEDPYAKMTFWEVDLKEKFSAELDQFPFG"
BASE COUNT      152 a     85 c     83 g    138 t
ORIGIN      
        1 gcacagggac ataacaatgg aatttgttgg cataatcaac tgtttctaac tgttgtatat
       61 actaccagaa gtacaaactt ttctgtttgt gtaggcacac aatccacaag tacaaatcca
      121 ccatatgcaa acactaattt taaggaatac ctaaggcatg cagaagagta tgacctcgag
      181 tttgtgtttc agttatgcaa aattacttta actacagatg taatgacata tatacattct
      241 atgagttcta gtatattaga acagtggaat tttggtctta caccaccgcc atctggtact
      301 ttagaagaaa catatagata tgtaacttca caggccatta catgtcagcg tccgcaacct
      361 cctaaggaat ctgaggatcc atatgctaaa atgacatttt gggaggtaga ccttaaagaa
      421 aagttttctg cagaattaga tcagtttcct tttggacg