LOCUS       HPV62MY911    449 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 62 (HPV-62), partial L1 cds, My09/My11 
            region.
ACCESSION   U12499
SOURCE      Human papillomavirus type 62 DNA isolated from a patient with
            vulvar intraepithelial neoplasia (VaIN).
  ORGANISM  Human papillomavirus type 62
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 449)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPV-62 has recently been characterized and isolated from a vulvar
            intraepithelial neoplasia by Dr. T. Matsukura.  The cloned DNA
            was subsequently sequenced by Dr. H. Delius over the L1 MY09/MY11
            segment.  HPV-62 and the several other types recently sequenced
            over this region by Dr. Delius were used as type-specific probes to
            screen DNA for novel genital HPV types.  The screened DNA was 
            obtained from four recent epidemiological studies. Primer regions
            are annotated in the sequence; information in this region is not
            accurate due to primer degeneracy.

FEATURES             Location/Qualifiers
     CDS             <1..>449
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWFNELFVTVVDTTRSTNFTICTASTAAAEYTATNF
                     REFLRHTEEFDLQFIFQLCKIQLTPEIMAYLHNMNKDLLDDWNFGVLPPPSTSLDETY
                     HYFESRAITCQRGLPTRPKVDPYAQMTFWTVDLKDKLSTDLDQFPLG"
BASE COUNT      116 a     92 c     99 g    142 t
ORIGIN      
        1 gcacagggtc ataataatgg tatttgttgg tttaatgaac tgtttgttac tgtggtggat
       61 actaccagaa gtactaattt tactatttgt accgcctcca ctgctgcagc agaatacacg
      121 gctaccaact ttagggaatt tttgcgacac acggaggaat ttgatttgca atttatattt
      181 caattgtgca aaatacagtt aacccccgaa attatggcct acctgcataa tatgaacaag
      241 gaccttttgg atgactggaa ctttggggtt ttacctcccc cttccactag tttagatgag
      301 acatatcact atttcgagtc tcgggctatt acatgtcaaa gggggctgcc tacccgtccc
      361 aaggtggacc cgtatgcgca aatgacattt tggactgtgg atcttaagga caagttgtct
      421 actgatttgg atcagtttcc cttgggttg