LOCUS       HPV59MY911    452 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 59 (HPV-59), partial L1 cds, My09/My11 
            region.
ACCESSION   U12496
SOURCE      Human papillomavirus type 59 DNA.
  ORGANISM  Human papillomavirus type 59
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 452)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPV-59 was first isolated from a vulvar intraepithelial neoplasia
            of the genital mucosa.  Cloned HPV-59 DNA was obtained from the
            Papillomavirus Reference Center, Heidelberg and subsequently
            sequenced by Dr. H. Delius over the L1 MY09/MY11 segment.  HPV-59
            and the several other HPV types recently sequenced over this
            region by Dr. Delius were used as type-specific probes to screen 
            DNA for novel genital HPV types.  The screened DNA was obtained 
            from four recent epidemiological studies.  Primer regions are
            annotated in the sequence; information in this region is not
            accurate due to primer degeneracy.

FEATURES             Location/Qualifiers
     CDS             <1..>452
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGLNNGICWHNQLFLTVVDTTRSTNLSVCALLLSIPNVYTPTS
                     FKEYARHVEEFDLQFIFQLCKITLTTEVMSYIHNMNTTILEDWNFGVTPPPTASLVDT
                     YRFVQSAAVTCQKDTAPPVKQDPYDKLKFWPVDLKERFSADLDQFPLG"
BASE COUNT      130 a     88 c     83 g    151 t
ORIGIN      
        1 gctcagggtt taaacaatgg tatatgttgg cacaatcaat tgtttttaac agttgtagat
       61 actactcgca gcaccaatct ttctgtgtgt gctctactac tctctattcc taatgtatac
      121 acacctacca gttttaaaga atatgccaga catgtggagg aatttgattt gcagtttata
      181 tttcaactgt gtaaaataac attaactaca gaggtaatgt catacattca taatatgaat
      241 accactattt tggaggattg gaattttggt gttacaccac ctcctactgc tagtttagtt
      301 gacacatacc gttttgttca atctgctgct gtaacttgtc aaaaggacac cgcaccgcca
      361 gttaaacagg acccttatga caaactaaag ttttggcctg tagatcttaa ggaaaggttt
      421 tctgcagatc ttgatcagtt tcctttggga cg