LOCUS       HPV55MY911    455 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 55 (HPV-55), partial L1 cds, My09/My11
            region.
ACCESSION   U12494
SOURCE      Human papillomavirus type 55 DNA.
  ORGANISM  Human papillomavirus type 55
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 455)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPV-55 was first isolated from a penile condyloma acuminata. 
            Cloned HPV-55 DNA was obtained from the Papillomavirus Reference 
            Center, Heidelberg and subsequently sequenced by Dr. H. Delius 
            over the L1 MY09/MY11 segment.  HPV-55 and the several other HPV 
            types recently sequenced over the MY09/MY11 primer region by Dr. 
            Delius were used as type-specific probes to screen DNA for novel 
            genital HPV types.  The screened DNA was obtained from four recent 
            epidemiological studies.  Primer regions are annotated in the
            sequence; information in this region is not accurate due to primer
            degeneracy.

FEATURES             Location/Qualifiers
     CDS             <1..>455
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWGNQLFVTVVDTTRSTNMTICAATTQSPSTTYNST
                     EYKQYMRHVEEFDLQFMFQLCSITLTAEVMAYLHTMNPGILEQWNFGLSPPPNGTLED
                     KYRYVQSQAITCQKPPPEKAKQDPYAKLSFWEVDLREKFSSELDQYPLG"
BASE COUNT      143 a     86 c     94 g    132 t
ORIGIN      
        1 gcgcagggcc acaataatgg tatttgttgg gggaatcagt tatttgttac tgttgtagat
       61 actacacgta gtacaaacat gacaatatgt gctgctacaa ctcagtctcc atctacaaca
      121 tataatagta cagaatataa acaatacatg cgacatgttg aggagtttga cttacagttt
      181 atgtttcaat tatgtagtat taccttaact gctgaggtaa tggcctattt acataccatg
      241 aatcctggta ttttggaaca gtggaacttt gggttgtcgc cacccccaaa tggtacctta
      301 gaagacaaat acagatatgt gcagtcacag gccattacat gtcaaaagcc tccccctgaa
      361 aaggcaaagc aggaccccta tgcaaaatta agtttttggg aggtagatct cagagaaaag
      421 ttttctagtg agttagatca atatcccctt ggtag