LOCUS       HPV54MY911    452 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 54 (HPV-54), partial L1 cds, My09/My11 
            region.
ACCESSION   U12501
SOURCE      Human papillomavirus type 54 DNA.
  ORGANISM  Human papillomavirus type 54
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 452)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPV-54 was first isolated from a patient with condyloma acuminata.
            Cloned HPV-54 DNA was obtained from the Papillomavirus Reference 
            Center, Heidelberg and subsequently sequenced by Dr. H. Delius over
            the L1 MY09/MY11 segment.  HPV-54 and the several other HPV types 
            recently sequenced over this region by Dr. Delius were used as 
            type-specific probes to screen DNA for novel genital HPV types.
            The screened DNA was obtained from four recent epidemiological 
            studies.  Primer regions are annotated in the sequence; information
            in this region is not accurate due to primer degeneracy.
 
FEATURES             Location/Qualifiers
     CDS             <1..>452
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWGNQLFLTVVDTTRSTNLTLCATASTQDSFNNSDF
                     REYIRHVEEYDLQFTFQLCTIALTADVMAYIHGMNPTILEDWNFGITPPATSSLEDTY
                     RFVQSQAIACQKNNAPAKEKEDPYSKFTFWTVDLKERFSSDLDQYPLG"
BASE COUNT      134 a     87 c     94 g    137 t
ORIGIN      
        1 gcacagggtc ataataatgg tatttgttgg ggcaatcaat tgtttttaac agttgtagat
       61 accacccgta gtactaacct aacattgtgt gctacagcat ccacgcagga tagctttaat
      121 aattctgact ttagggagta tattagacat gtggaggaat atgatttaca gtttacattt
      181 cagttatgta ccatagccct tacagcagat gttatggcct atattcatgg aatgaatccc
      241 actattctag aggactggaa ctttggtata acccccccag ctacaagtag tttggaggac
      301 acatataggt ttgtacagtc acaggccatt gcatgtcaaa agaataatgc ccctgcaaag
      361 gaaaaggagg atccttacag taaatttact ttttggactg ttgaccttaa ggaacgattt
      421 tcatctgacc ttgatcagta tccccttgga cg