LOCUS       HPV44E6       590 bp ds-DNA             VRL       15-SEP-1989
DEFINITION  Human papillomavirus type 44 (HPV-44), E6 region.
ACCESSION   M27023
SOURCE      Human papillomavirus type 44 DNA recovered from a vulvar
            condyloma.
  ORGANISM  Human papillomavirus type 44
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus. 
REFERENCE   1  (bases 1 to 590)
  AUTHORS   Lorincz,A.T., Quinn,A.P., Goldsborough,M.D., Schmidt,B.J. and
            Temple,G.F.
  TITLE     Cloning and partial DNA sequencing of two new human papillomavirus
            types associated with condylomas and low-grade cervical neoplasia
  JOURNAL   J. Virol. 63, 2829-2834 (1989)
  STANDARD  full staff_review
COMMENT     HPV-44 is a mucosatropic HPV which to date has not been detected in
            cervical cancer.  Prevalence studies indicate that HPV-44 and HPV-43
            have been found in 4% of cervical intraepithelial neoplasms, but in
            none of the 56 cervical cancers tested.   

            During the analysis of approximately 1000 anogenital tissue samples,
            two new HPV types, HPV-43 and HPV-44, were identified.  The complete
            genome of HPV-44 was recovered from a vulvar condyloma and cloned
            into bacteriophage lambda.  The biopsy was taken from a woman from
            the Detroit Michigan area.  The DNA recovered was a single 7.8 kb
            BamHI fragment.  Only the E6 region of the cloned sample has been
            sequenced, although the positions of the ORFs for the entire genome
            have been deduced and are consistent with the organization of DNA
            from HPV-6b.  A possible feature of HPV types associated with
            malignant lesions is the potential to produce a different E6 protein
            by alternative splicing.  This potential has been found in types
            HPV-16, HPV-18, and HPV-31.  HPV-44 has a potential E6 splice donor
            at nt 229, but does not contain a potential splice acceptor.   

FEATURES             Location/Qualifiers
     CDS             103..555
                     /note="putative"
                     /note="ORF E6 from bp 70 to 555"
                     /product="transforming protein"
                     /gene="E6"
                     /note="putative"
                     /codon_start=1
                     /translation="MESANASTSAQSIDQLCKECNIPMHNLQILCVFCRKTLSTAEVY
                     SFAYKQLYVVYRGNFPFAACAICLELQGKVNQFRHFNYAGYAVTVEEETNKSILDVLI
                     RCYLCHKPLCHVEKVRHILDKARFIKLQDTWKGRCFHCWTSCMETILP"
BASE COUNT      197 a    117 c    124 g    152 t
ORIGIN      102 bp upstream from beginning of E6 cds
        1 aataataatc taacctttac aaaaaagagg aggaaccgaa ttcggttcca accgaaaacg
       61 gttatataaa aaccagccca aaaattaagc aagcggggca taatggaaag tgcaaatgcc
      121 tccacgtctg cacaaagtat agaccagttg tgcaaggagt gcaacattcc tatgcacaat
      181 ctgcaaattt tatgcgtgtt ttgcagaaaa acgttaagta ctgcagaggt ttattcattc
      241 gcatataaac agttatatgt agtgtaccga ggaaactttc catttgcagc ctgtgccatt
      301 tgtttagaac tacaaggtaa ggtcaatcaa tttaggcatt ttaactacgc gggatatgca
      361 gtaacagtgg aagaagaaac aaataagtca attctggacg tgctgatacg ctgctatttg
      421 tgccacaaac cattgtgcca cgtggaaaag gtgcgccaca tattggacaa ggcgcgattc
      481 attaaattac aagatacctg gaagggtcgc tgcttccatt gttggacatc atgcatggaa
      541 actatactac cttaaaggaa attgttttac agctggaacc tcctgaccct