LOCUS       HPV43MY911    455 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 43 (HPV-43), partial L1 cds, My09/My11 
            region.
ACCESSION   U12504
SOURCE      Human papillomavirus type 43 DNA recovered from a patient with 
            vulvar hyperplasia.
  ORGANISM  Human papillomavirus type 43
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 455)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPV-43 was first isolated from a patient with vulvar hyperplasia.  
            The cloned DNA was provided by Dr. A. Lorincz and was subsequently
            sequenced by Dr. H. Delius over the L1 MY09/MY11 segment.  HPV-43 
            and the several other types recently sequenced over this region by
            Dr. Delius were used as type-specific probes to screen DNA for novel
            genital HPV types.  The screened DNA was obtained from four recent
            epidemiological studies.  Primer regions are annotated in the
            sequence; information in this region is not accurate due to primer
            degeneracy.

FEATURES             Location/Qualifiers
     CDS             <1..>455
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICFGNQLFVTVVDTTRSTNLTLCASTDPTVPSTYDNA
                     KFKEYLRHVEEYDLQFIFQLCIITLNPEVMTYIHTMDPTLLEDWNFGVSPPASASLED
                     TYRFLSNKAIACQKNAPPKEREDPYKKYTFWDINLTEKFSAQLTQFPLG"
BASE COUNT      134 a     93 c     89 g    139 t
ORIGIN      
        1 gcccagggac ataataatgg catttgtttt gggaatcagt tgtttgttac agtggtagat
       61 accactcgta gtacaaactt gacgttatgt gcctctactg accctactgt gcccagtaca
      121 tatgacaatg caaagtttaa ggaatacttg cggcatgtgg aagaatatga tctgcagttt
      181 atatttcaat tatgcataat aacgctaaac ccagaggtta tgacatatat tcatactatg
      241 gatcccacat tattagagga ctggaatttt ggtgtgtccc cacctgcctc tgcttctttg
      301 gaagatactt atcgcttttt gtctaacaag gccattgcat gtcaaaaaaa tgctccccca
      361 aaggaacggg aggatcccta taaaaagtat acattttggg atataaatct tacagaaaag
      421 ttttctgcac aacttaccca gtttccctta ggcgc