LOCUS       HPV43E6       591 bp ds-DNA             VRL       15-SEP-1989
DEFINITION  Human papillomavirus type 43 (HPV-43), E6 region.
ACCESSION   M27022
SOURCE      Human papillomavirus type 43 DNA recovered from a vulvar
            biopsy with hyperplasia.
  ORGANISM  Human papillomavirus type 43
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 591)
  AUTHORS   Lorincz,A.T., Quinn,A.P., Goldsborough,M.D., Schmidt,B.J. and
            Temple,G.F.
  TITLE     Cloning and partial DNA sequencing of two new human papillomavirus
            types associated with condylomas and low-grade cervical neoplasia
  JOURNAL   J. Virol. 63, 2829-2834 (1989)
  STANDARD  full staff_review
COMMENT     HPV-43 is a mucosatropic HPV which to date has not been detected in
            cervical cancer.  Prevalence studies indicate that HPV-44 and HPV-43
            have been found in 4% of cervical intraepithelial neoplasms, but in
            none of the 56 cervical cancers tested.
 
            During an analysis of approximately 1000 anogenital tissue samples,
            two new HPV types, HPV-43 and HPV-44, were identified.  The complete
            genome of HPV-43 was recovered from a vulvar biopsy and cloned into
            bacteriophage lambda.  The biopsy was taken from a woman living in
            the Detroit Michigan area.  The DNA consisted of two fragments: a 
            6.3 kb BamHI fragment and a 2.9 kb HindIII fragment.  The total 
            quantity of unique DNA was 7.6 kb.  Only the E6 region of the cloned
            sample has been sequenced, although all positions of the ORFs
            have been deduced and are consistent with the organization of DNA
            from HPV-6b.  A possible feature of HPV types associated with
            malignant lesions is the potential to produce a different E6
            protein by alternative splicing.  This potential has been found in
            types HPV-16, HPV-18, and HPV-31.  HPV-43 has both the potential E6
            splice donor site at nt 233 and the potential splice acceptor at
            nt 413.
 
FEATURES             Location/Qualifiers
     CDS             107..574
                     /note="putative"
                     /note="ORF E6 from bp 32 to 574"
                     /product="transforming protein"
                     /gene="E6"
                     /note="putative"
                     /codon_start=1
                     /translation="MSARSCSQNARTIFELCDECNITLPTLQIGCIFCKKWLLTTEVL
                     SFAFRDLRVVWRDGYPFAACLACLQFHGKISQYRHFDYAAYADTVEEETKQTVFDLCI
                     RCCKCHKPLSPVEKVQHIVQKAQFFKIHSVWKGYCLHCWKSCMEKRRRSETMC"
BASE COUNT      189 a    110 c    133 g    159 t
ORIGIN      106 bp upstream from beginning of E6 cds
        1 attactaaca attattatac ttgtagttta agggtgggac cgaaaacggt ccgaccgaaa
       61 gcggtacata tataaaccac ccaaaaacca tagcttgtgg ggcataatgt ctgcacgtag
      121 ctgctcccaa aacgcacgga ctatatttga gttgtgtgat gagtgtaaca taactttgcc
      181 tactctgcaa attgggtgca tattttgcaa gaagtggtta cttaccacgg aagtattatc
      241 gtttgcattt agagatttaa gggttgtgtg gcgcgacgga tatccgtttg ctgcatgctt
      301 ggcctgtcta cagtttcatg gaaaaataag tcaatatagg cactttgact acgcagcata
      361 tgcagatact gtagaagaag aaacaaagca aacagtgttt gatttgtgca ttagatgctg
      421 taagtgccac aagccattat caccagtgga aaaagtacag catattgtgc aaaaggcaca
      481 attctttaaa atacatagcg tgtggaaagg atactgctta cattgctgga aatcatgcat
      541 ggaaaaacgc cgacgatcag agactatgtg ctaactatgc aaccagaacc t
//