LOCUS       HPV29MY911    455 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 29 (HPV-29), partial L1 cds, My09/My11
            region.
ACCESSION   U12503
SOURCE      Human papillomavirus type 29 DNA.
  ORGANISM  Human papillomavirus type 29
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 455)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPV-29 was originally isolated from a skin wart.  Subsequent
            tests failed to detect it in cutaneous wart specimens from 119
            patients, including both butchers and immunosuppressed patients.
            These latter were included in the study on the basis of HPV-29's
            similarity to members of the group including HPV-10 and HPV-3,
            which are frequently detected in such patients.  It thus seems
            to be a relatively uncommon member of this group (Favre et al.
            J. Virol. 63, 4906).

            Cloned HPV-29 DNA was obtained from the Papillomavirus Reference
            Center, Heidelberg and subsequently sequenced by Dr. H. Delius over
            the L1 MY09/MY11 segment.  HPV-29 and the several other HPV types
            recently sequenced over this region by Dr. Delius were used as 
            type-specific probes to screen DNA for novel genital HPV types.
            The screened DNA was obtained from four recent epidemiological 
            studies [1].  Primer regions are annotated in the sequence;
            information in this region is not accurate due to primer
            degeneracy.

FEATURES             Location/Qualifiers
     CDS             <1..>455
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWANQVFLTVVDTTRSTNMSLCATTESQPLTTYDAT
                     KIKEYLRHGEEYDLQFIFQLCKVTLTPEIMAYLHTMNSALLEDWNFGLTLPPSTSLED
                     TYRFVTSSAITCQKDLAPTEKQDPYAKLNFWDVDLKDRFTLDLSQFPLG"
BASE COUNT      132 a     92 c     99 g    132 t
ORIGIN      
        1 gcgcagggac acaacaatgg tatatgctgg gccaatcagg tatttttaac tgtggtggac
       61 accacacgca gcaccaatat gtcgttgtgt gctaccacag agtctcaacc gttgaccact
      121 tatgatgcta ccaagattaa agaatatttg agacatgggg aggaatatga tttgcagttt
      181 attttccagt tgtgtaaagt tacattgaca cctgaaatta tggcttacct tcatactatg
      241 aacagtgcct tacttgaaga ctggaatttt ggattgacat tgccaccttc cactagcttg
      301 gaagacacgt ataggtttgt aacatcctct gccataactt gtcaaaaaga tttggcccct
      361 acagaaaagc aggatccgta tgcaaagcta aatttctggg atgtagattt aaaggataga
      421 tttaccctgg atttgtcaca gtttcccctg ggacg