LOCUS       HPV28MY911    449 bp ds-DNA             VRL       16-OCT-1994
DEFINITION  Human papillomavirus type 28 (HPV-28), partial L1 cds, My09/My11
            region.
ACCESSION   U12502
SOURCE      Human papillomavirus type 28 DNA.
  ORGANISM  Human papillomavirus type 28
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae;
            Papillomavirus.
REFERENCE   1  (bases 1 to 449)
  AUTHORS   Bernard,H.-U., Chan,S.-Y., Manos,M.M., Ong,C.-K., Villa,L.L.,
            Delius,H., Peyton,C.L., Bauer,H.M., and Wheeler,C.M.
  TITLE     Identification and assessment of known and novel human
            papillomaviruses by PCR amplification, restriction fragment
            length polymorphisms, nucleotide sequence, and phylogenetic
            algorithms
  JOURNAL   J. Infect. Dis. (1994) In press
  STANDARD  full staff_review
COMMENT     HPV-28 was originally isolated from butchers' warts (Favre et al.
            J. Virol. 63, 4905).  Subsequent tests revealed it to be present 
            in 7 of 130 butchers suffering from warts, in 3 of 66 wart patients 
            and in 1 of 55 immunosuppressed patients.  It has been detected in 
            flat warts and intermediate warts.  It is most closely related to 
            HPV-3 and HPV-10.

            Cloned HPV-28 DNA was obtained from the Papillomavirus Reference 
            Center, Heidelberg and subsequently sequenced by Dr. H. Delius
            over the L1 MY09/MY11 segment.  HPV-28 and the several other HPV
            types recently sequenced over the MY09/MY11 primer region by Dr. 
            Delius were used as type-specific probes to screen DNA for novel
            genital HPV types.  The screened DNA was obtained from four recent
            epidemiological studies [1].  Primer regions are annotated in the
            sequence; information in this region is not accurate due to primer
            degeneracy.

FEATURES             Location/Qualifiers
     CDS             <1..>449
                     /note="putative"
                     /product="major capsid protein"
                     /gene="L1"
                     /note="putative"
                     /codon_start=1
                     /translation="AQGHNNGICWANQLFVTVVDTTRSTNMTLCVSTDSSATYDASKF
                     KEYLRHGEEYDLQFIFQLCKVTLTPDIMAYLHTMNNSLLEDWNFGLTLPPSTSLEDTY
                     RFISSSAITCQKDASPTTKEDPYAKLNFWEVDLKDRFSLDLSQFPLG"
BASE COUNT      123 a     95 c     95 g    136 t
ORIGIN      
        1 gctcagggac acaataatgg tatctgttgg gccaaccaat tgtttgtaac tgtagtggat
       61 actacacgca gtacaaacat gacgttgtgt gtttctactg actcttcagc tacgtacgat
      121 gctagtaaat ttaaggaata cttaaggcac ggggaggagt acgatttgca gtttatattc
      181 cagttgtgta aagtaacctt gacccctgat attatggcat atttacatac catgaacaat
      241 agtttattgg aggactggaa ctttgggttg actttaccac catccactag cttggaggac
      301 acgtataggt tcatatcttc ctctgccatt acctgtcaaa aggatgcttc ccccactacc
      361 aaggaagacc cttacgctaa actaaacttt tgggaagtgg atcttaagga tcgcttttct
      421 cttgatctat cgcaattccc tctgggaag