LOCUS       HPV21E7       306 bp    DNA             VRL       18-MAY-1995
DEFINITION  Human papillomavirus type 21 gene for hypothetical E7 protein.
ACCESSION   D50548
KEYWORDS    hypothetical E7 protein.
SOURCE      Human papillomavirus type 21 DNA.
  ORGANISM  Human papillomavirus type 21
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae.
REFERENCE   1  (bases 1 to 306)
  AUTHORS   Adachi,A., Kiyono,T., Ohashi,M. and Ishibashi,M.
  TITLE     Detection of human papillomavirus type 47 DNA in malignant lesions
            of epidermodysplasia verruciformis with protocols for precise
            typing of the related HPV DNAs
  JOURNAL   Unpublished (1995)
COMMENT
            This locus, HPV21E7, is called PPHE7D by GenBank and DDBJ.
            Submitted (11-May-1995) to DDBJ by:
            Tohru Kiyono
            Aichi Cancer Center Research Institute
            Laboratory of Viral Oncology
            1-1 Kanokoden, Chikusa-ku
            Nagoya, Aichi 464
            Japan
            Phone: 052-762-6111 x8838
            Fax:   052-763-5233
            Email: h44714u@nucc.cc.nagoya-u.ac.jp.
            
            NCBI gi: 808883
FEATURES             Location/Qualifiers
     source          1..306
                     /organism="Human papillomavirus type 21"
                     /sequenced_mol="DNA"
     CDS             1..306
                     /partial
                     /gene="E7"
                     /standard_name="E7 protein"
                     /note="putative;  NCBI gi: 808884"
                     /codon_start=1
                     /product="hypothetical E7 protein"
                     /translation="MIGKEVTLQDIVLELNELQPEVQPVDLFCEEELPSEQQETEEEL
                     PERTSYKVVTPCGCCKVKLRIFVNATRFAIRTFQNLLFEELQLLCPECRGNCKHGGS"
BASE COUNT       88 a     59 c     81 g     78 t
ORIGIN      
        1 atgattggta aagaggtcac attgcaagat attgttctgg agttaaatga attgcagcct
       61 gaggtacaac cagttgacct gttttgtgaa gaggagttac cgagcgagca gcaggaaaca
      121 gaggaggagc taccagaaag gacctcgtac aaagttgtta caccttgcgg ctgctgcaag
      181 gtcaagcttc gcatctttgt aaacgctaca cgatttgcta ttagaacatt tcagaatctg
      241 ctgtttgaag aattgcagct gttgtgtcct gagtgccgcg gaaactgcaa acatggcgga
      301 tcctaa