LOCUS       HPV20E7       309 bp    DNA             VRL       18-MAY-1995
DEFINITION  Human papillomavirus type 20 gene for hypothetical E7 protein.
ACCESSION   D50547
KEYWORDS    hypothetical E7 protein.
SOURCE      Human papillomavirus type 20 DNA.
  ORGANISM  Human papillomavirus type 20
            Viridae; ds-DNA nonenveloped viruses; Papovaviridae.
REFERENCE   1  (bases 1 to 309)
  AUTHORS   Adachi,A., Kiyono,T., Ohashi,M. and Ishibashi,M.
  TITLE     Detection of human papillomavirus type 47 DNA in malignant lesions
            of epidermodysplasia verruciformis with protocols for precise
            typing of the related HPV DNAs
  JOURNAL   Unpublished (1995)
COMMENT
            This locus, HPV20E7, is called PPHE7C by GenBank and DDBJ.
            Submitted (11-May-1995) to DDBJ by:
            Tohru Kiyono
            Aichi Cancer Center Research Institute
            Laboratory of Viral Oncology
            1-1 Kanokoden, Chikusa-ku
            Nagoya, Aichi 464
            Japan
            Phone: 052-762-6111 x8838
            Fax:   052-763-5233
            Email: h44714u@nucc.cc.nagoya-u.ac.jp.
            
            NCBI gi: 808881
FEATURES             Location/Qualifiers
     source          1..309
                     /organism="Human papillomavirus type 20"
                     /sequenced_mol="DNA"
     CDS             1..309
                     /partial
                     /gene="E7"
                     /standard_name="E7 protein"
                     /note="putative;  NCBI gi: 808882"
                     /codon_start=1
                     /product="hypothetical E7 protein"
                     /translation="MIGKEVTLQDIVLELNELQPEVQPVDLFCEEELPNEQQER
                     EEEPQIERASYKVVAPCGCCKVKLRIFISATEFAIRSFQQLLIDELQLLCPDCR
                     GNCKHGGS"
BASE COUNT       87 a     58 c     84 g     80 t
ORIGIN      
        1 atgattggta aagaggtcac attgcaagat attgttctgg agttaaatga attgcagcct
       61 gaggttcaac cagttgacct gttttgtgaa gaggagttac cgaacgagca gcaggagaga
      121 gaggaggagc ctcagattga aagagcctca tacaaagttg ttgcaccttg cggctgctgc
      181 aaggtgaaac ttcgcatctt tataagcgct acagaatttg ctattagaag ctttcaacaa
      241 ttgctgattg acgagctgca gctgttgtgt cctgactgtc gcgggaactg caaacatggc
      301 ggatcctaa