ID HPVRTRX6 STANDARD; DNA; VRL; 267 bp. XX DE Human papillomavirus unidentified type (RTRX6) L1 gene, partial cds. XX AC L38923 XX DT 13-JAN-1995 XX OS Human papillomavirus unidentified type (RTRX6) DNA. OC Human papillomavirus unidentified type (RTRX6);Viridae; ds-DNA OC nonenveloped viruses; Papovaviridae. XX RN [1] RP 1 - 267 RA Berkhout,R.J., Tieben,L.M., Smits,H.L., Bavinck,J.N., Vermeer,B.J.and RA ter Schegget,J; RT "Nested PCR approach for detection and typing of epidermodysplasia RT verruciformis-associated human papillomavirus types in cutaneous RT cancers from renal transplant recipients;" RL J. Clin. Microbiol. 33 (3), 690-695 (1995)95270695. XX XX Created by HIV database on 1-NOV-1995 from GenBank: L38923. XX XX HPVRTRX6 was isolated from a renal transplant patient [1], XX FT KEY Location/Qualifiers FT source 1..267 FT /organism="Human papillomavirus unidentified type (RTRX6)" FT /sequenced_mol="DNA" FT /specific_host="Homo sapiens" FT CDS <1..>267 FT /gene="L1" FT /note="NCBI gi: 623472" FT /codon_start=1 FT /translation="ICVPSDAGAVTEYDSSKFREFLRHVEEYQISVILQLCKVSLQPD FT VLAQINAMNSGILEDWQLGFVPTPDNAVHDTYRFINSSATKCPDK" XX SQ SEQUENCE 267 bp; 89 a; 46 c; 52 g; 80 t; atttgtgtac cttcagatgc aggtgctgta actgagtatg attctagcaa atttagagaa 60 tttttaaggc acgtggaaga gtatcaaata tctgtaatat tacaactgtg taaagtatca 120 ctgcaacctg atgtgctagc ccagatcaat gcaatgaatt caggtatatt agaagattgg 180 cagttaggat ttgtaccaac tcctgacaat gcagtacatg acacctatag atttataaat 240 tcctcagcca ctaaatgtcc agataag 267