ID HPV36My911 STANDARD; DNA; VRL; 276 bp. XX DE Human papillomavirus type 36 L1 gene, partial cds. XX AC L38915 XX DT 13-JAN-1995 XX OS Human papillomavirus type 36 (individual_isolate Kremsdorf et al.) DNA. OS OC Human papillomavirus type 36;Viridae; ds-DNA nonenveloped viruses; OC Papovaviridae. XX RN [1] RP 1 - 276 RA Berkhout,R.J.M., Tieben,L.M., Smits,H.L., Bouwes RA Bavinck,J.N.,Vermeer,B.J. and Schegget,J; RT "Detection and typing of epidermodysplasia verruciformis-associated RT Human Papillomavirus types in cutaneous cancers from renal transplant RT recipients: a nested approach;" RL J. Clin. Microbiol. (1995) In press. XX XX Created by HIV database on 1-NOV-1995 from GenBank: L38915. XX XX XX FT KEY Location/Qualifiers FT source 1..276 FT /organism="Human papillomavirus type 36" FT /isolate="Kremsdorf et al." FT /sequenced_mol="DNA" FT /specific_host="Homo sapiens" FT CDS <1..>276 FT /gene="L1" FT /note="NCBI gi: 623456" FT /codon_start=1 FT /translation="ISIYNNNGALKDINDYTAEQFREYQRHVEEYEISLILQLCKVPL FT KAEVLAQINAMNSSLLEDWQLGFVPTPDNPIHDTYRYIDSLATRCPDK" XX SQ SEQUENCE 276 bp; 92 a; 47 c; 51 g; 86 t; atttcaatat ataacaataa tggggcacta aaggacatca atgattacac tgcagagcaa 60 tttagagaat atcaaaggca cgtggaggaa tatgaaattt cattaatatt acagctatgt 120 aaggttcctc tgaaggcaga agtattggct cagatcaatg ctatgaattc ttctttattg 180 gaagattggc agttaggttt tgttcctact ccagataatc ctattcatga cacctatcga 240 tatattgatt cattagccac tcgctgtcca gataaa 276