ID HPV21My911 STANDARD; DNA; VRL; 276 bp. XX DE Human papillomavirus type 21 L1 gene, partial cds. XX AC L38911 XX DT 13-JAN-1995 XX OS Human papillomavirus type 21 (individual_isolate Kremsdorf et al.) DNA. OS OC Human papillomavirus type 21;Viridae; ds-DNA nonenveloped viruses; OC Papovaviridae. XX RN [1] RP 1 - 276 RA Berkhout,R.J.M., Tieben,L.M., Smits,H.L., Bouwes RA Bavinck,J.N.,Vermeer,B.J. and Schegget,J; RT "Detection and typing of epidermodysplasia verruciformis-associated RT Human Papillomavirus types in cutaneous cancers from renal transplant RT recipients: a nested approach;" RL J. Clin. Microbiol. (1995) In press. XX XX Created by HIV database on 1-NOV-1995 from GenBank: L38911. XX XX XX FT KEY Location/Qualifiers FT source 1..276 FT /organism="Human papillomavirus type 21" FT /isolate="Kremsdorf et al." FT /sequenced_mol="DNA" FT /specific_host="Homo sapiens" FT CDS <1..>276 FT /gene="L1" FT /note="NCBI gi: 623448" FT /codon_start=1 FT /translation="ISVNSENRDVSKIENYKAESFQEYLTHVEEYELSLILQLCKVPL FT TAEVLAQINAMNANILEEWQLGFVPAPDNPIHDTYRYIDSAATRCPDK" XX SQ SEQUENCE 276 bp; 100 a; 44 c; 44 g; 88 t; atttcagtaa attctgagaa tcgagacgtg tctaaaattg aaaattataa agccgagagc 60 tttcaagaat atttaacaca cgttgaagaa tatgaacttt ctttaatttt acaattatgt 120 aaagttcctt taacagcaga agtcttagct caaattaatg caatgaatgc aaatatttta 180 gaagaatggc agttaggatt tgttcctgcc ccagacaatc ctattcatga tacatataga 240 tacattgact ctgcagctac tagatgtcct gataaa 276