ID HPV21E7 STANDARD; DNA; VRL; 306 bp. XX DE Human papillomavirus type 21 gene for hypothetical E7 protein. XX AC D50548 XX DT 18-MAY-1995 XX OS Human papillomavirus type 21 DNA. OC Human papillomavirus type 21;Viridae; ds-DNA nonenveloped viruses; OC Papovaviridae. XX RN [1] RP 1 - 306 RA Adachi,A., Kiyono,T., Ohashi,M. and Ishibashi,M; RT "Detection of human papillomavirus type 47 DNA in malignant lesions of RT epidermodysplasia verruciformis with protocols for precise typing of RT the related HPV DNAs;" RL Unpublished (1995). XX XX Created by HIV database on 1-NOV-1995 from GenBank: D50548. XX XX XX FT KEY Location/Qualifiers FT source 1..306 FT /organism="Human papillomavirus type 21" FT /sequenced_mol="DNA" FT CDS 1..306 FT /partial FT /gene="E7" FT /standard_name="E7 protein" FT /note="putative; NCBI gi: 808884" FT /codon_start=1 FT /product="hypothetical E7 protein" FT /translation="MIGKEVTLQDIVLELNELQPEVQPVDLFCEEELPSEQQETEEEL FT PERTSYKVVTPCGCCKVKLRIFVNATRFAIRTFQNLLFEELQLLCPECRGNCKHGGS" XX SQ SEQUENCE 306 bp; 88 a; 59 c; 81 g; 78 t; atgattggta aagaggtcac attgcaagat attgttctgg agttaaatga attgcagcct 60 gaggtacaac cagttgacct gttttgtgaa gaggagttac cgagcgagca gcaggaaaca 120 gaggaggagc taccagaaag gacctcgtac aaagttgtta caccttgcgg ctgctgcaag 180 gtcaagcttc gcatctttgt aaacgctaca cgatttgcta ttagaacatt tcagaatctg 240 ctgtttgaag aattgcagct gttgtgtcct gagtgccgcg gaaactgcaa acatggcgga 300 tcctaa 306