ID HPV20My911 STANDARD; DNA; VRL; 276 bp. XX DE Human papillomavirus type 20 L1 gene, partial cds. XX AC L38910 XX DT 13-JAN-1995 XX OS Human papillomavirus type 20 (individual_isolate Kremsdorf et al.) DNA. OS OC Human papillomavirus type 20;Viridae; ds-DNA nonenveloped viruses; OC Papovaviridae. XX RN [1] RP 1 - 276 RA Berkhout,R.J.M., Tieben,L.M., Smits,H.L., Bouwes RA Bavinck,J.N.,Vermeer,B.J. and Schegget,J; RT "Detection and typing of epidermodysplasia verruciformis-associated RT Human Papillomavirus types in cutaneous cancers from renal transplant RT recipients: a nested approach;" RL J. Clin. Microbiol. (1995) In press. XX XX Created by HIV database on 1-NOV-1995 from GenBank: L38910. XX XX XX FT KEY Location/Qualifiers FT source 1..276 FT /organism="Human papillomavirus type 20" FT /isolate="Kremsdorf et al." FT /sequenced_mol="DNA" FT /specific_host="Homo sapiens" FT CDS <1..>276 FT /gene="L1" FT /note="NCBI gi: 623446" FT /codon_start=1 FT /translation="ISVHSENTDVFKIQNYNSQKFQEYLRHVEEYEISLILQLCKVPL FT TAEVLAQINAMNSNILEEWQLGFVPAPDNPIHDTYRYINSAATRCPDK" XX SQ SEQUENCE 276 bp; 101 a; 43 c; 40 g; 92 t; atatcagttc attcagaaaa cactgatgtt tttaaaattc aaaattataa ttctcagaaa 60 tttcaagaat atttaagaca cgtagaagaa tatgaaattt cattaatttt acagctctgt 120 aaagttcctt taacagctga agttttagct caaattaatg ctatgaattc aaatatatta 180 gaggagtggc agttaggatt cgttcctgca ccggataatc ctatccacga tacatacaga 240 tatattaatt ctgcagctac tagatgtcct gataaa 276