ID HPV20E7 STANDARD; DNA; VRL; 309 bp. XX DE Human papillomavirus type 20 gene for hypothetical E7 protein. XX AC D50547 XX DT 18-MAY-1995 XX OS Human papillomavirus type 20 DNA. OC Human papillomavirus type 20;Viridae; ds-DNA nonenveloped viruses; OC Papovaviridae. XX RN [1] RP 1 - 309 RA Adachi,A., Kiyono,T., Ohashi,M. and Ishibashi,M; RT "Detection of human papillomavirus type 47 DNA in malignant lesions of RT epidermodysplasia verruciformis with protocols for precise typing of RT the related HPV DNAs;" RL Unpublished (1995). XX XX Created by HIV database on 1-NOV-1995 from GenBank: D50547. XX XX XX FT KEY Location/Qualifiers FT source 1..309 FT /organism="Human papillomavirus type 20" FT /sequenced_mol="DNA" FT CDS 1..309 FT /partial FT /gene="E7" FT /standard_name="E7 protein" FT /note="putative; NCBI gi: 808882" FT /codon_start=1 FT /product="hypothetical E7 protein" FT /translation="MIGKEVTLQDIVLELNELQPEVQPVDLFCEEELPNEQQER FT EEEPQIERASYKVVAPCGCCKVKLRIFISATEFAIRSFQQLLIDELQLLCPDCR FT GNCKHGGS" XX SQ SEQUENCE 309 bp; 87 a; 58 c; 84 g; 80 t; atgattggta aagaggtcac attgcaagat attgttctgg agttaaatga attgcagcct 60 gaggttcaac cagttgacct gttttgtgaa gaggagttac cgaacgagca gcaggagaga 120 gaggaggagc ctcagattga aagagcctca tacaaagttg ttgcaccttg cggctgctgc 180 aaggtgaaac ttcgcatctt tataagcgct acagaatttg ctattagaag ctttcaacaa 240 ttgctgattg acgagctgca gctgttgtgt cctgactgtc gcgggaactg caaacatggc 300 ggatcctaa 309