ID OvPV1L1 STANDARD; DNA; VRL; 285 bp. XX DE Ovine papillomavirus L1 protein gene, partial cds. XX AC U21861 XX DT 13-JUL-1995 XX OS Ovine papillomavirus. OC Ovine papillomavirus;Viruses; dsDNA viruses, no RNA stage; OC Papovaviridae;Papillomavirus. XX RN [1] RP 1 - 285 RA Chan,S.-Y., Delius,H., Halpern,A.L. and Bernard,H.U; RT "Analysis of genomic sequences of 95 papillomavirus types - uniting RT typing, phylogeny and taxonomy;" RL Unpublishedfull automatic. XX RN [2] RP 1 - 285 RA Chan,S.-Y; RT "Direct Submission;" RL Submitted (23-FEB-1995) Shih-Yen Chan, Institute of Molecular andCell RL Biology, National University of Singapore, Lower Kent RidgeRoad, RL Singapore, 0511, Republic of Singaporefull automatic. XX XX Created by HIV database on 1-NOV-1995 from GenBank: U21861. XX XX NCBI gi: 896401 XX FT KEY Location/Qualifiers FT source 1..285 FT /organism="Ovine papillomavirus" FT CDS <1..>285 FT /note="NCBI gi: 896402" FT /gene="L1" FT /codon_start=1 FT /product="L1 protein" FT /translation="YHRHVEEYKLAFIFQLCSVQLTPETVSSLQGLMPSILQNWEVNV FT QPPASSILEDTYRYLESPATKCADNVSPTKPDPYDGLKFWKIDLKEKFSLD" XX SQ SEQUENCE 285 bp; 86 a; 59 c; 58 g; 82 t; tatcatagac acgtggaaga atataaacta gcattcatct ttcaactgtg ctctgtgcag 60 ttaacccctg aaacagtgag tagtctgcag gggttaatgc ccagcatttt gcaaaactgg 120 gaagtaaatg tacaacctcc tgcctcttca attctggaag atacctaccg ttatctagaa 180 tcgccagcca ctaagtgtgc agataatgtg tctcctacta agccagatcc ctatgatggg 240 ttaaaattct ggaagattga tctaaaagag aagttttctt tggat 285