ID CRPVSylE7 STANDARD; DNA; VRL; 381 bp. XX DE Papillomavirus sylvilagi Washington B (E7) gene, complete cds. XX AC U09494 XX DT 04-JUL-1994 XX OS Cottontail rabbit papillomavirus, CRPV-pLAII DNA. OC Papillomavirus sylvilagi;Vira; Viruses; dsDNA nonenveloped viruses; OC Papovaviridae;Papillomavirus. XX RN [1] RP 1 - 381 RA Brandsma,J; RT "Use of a rapid, efficient inoculation method to induce papillomas by RT cottontail rabbit papillomavirus DNA shows that E7 gene is required;" RL Proc. Natl. Acad. Sci. U.S.A. 88, 4816-4820 (1991)full automatic. XX RN [2] RP 1 - 381 RA Yaniv,M., Danos,O. and Giri,I; RT "Genomic structure of the cottontail rabbit (Shope) papillomavirus;" RL Proc. Natl. Acad. Sci. U.S.A. 82, 1580-1584 (1985)full automatic. XX RN [3] RP 1 - 381 RA Nasseri,M., and Wettstein,F; RT "A variant of CRPV DNA preferentially maintained as a plasmid in NIH RT 3T3 cells and characterization of its transcripts in nude mouse RT tumors;" RL Virology, Dec, 161(2), 541-548 (1987). XX XX Created by HIV database on 10-NOV-1995 from GenBank: U09494. XX XX NCBI gi: 507868 XX FT KEY Location/Qualifiers FT source 1..381 FT /lab_host="Oryctolagus cuniculus" FT /clone="pLAII-CRPV" FT /strain="Washington B" FT /organism="Papillomavirus sylvilagi" FT /specific_host="Sylvilagus floridanus" FT /note="submitter given name: Sylvilagus floridanus FT papillomavirus; corresponds to nt 1020-1400 of GenBank FT Accession Number K02708" FT conflict replace(55,"g") FT /citation=[2] FT CDS 56..340 FT /gene="E7" FT /note="NCBI gi: 507869" FT /codon_start=1 FT /translation="MIGRTPKLSELVLGETAEALSLHCDEALENLSDDDEEDHQDRQV FT HRERPYAVSVPCKRCRQTISFVCVCDPEAIRTLNRLLSASLSLVCPECCN" FT conflict replace(92,"t") FT /citation=[2] FT conflict replace(187^188,"tt") FT /citation=[2] FT conflict replace(190,"t") FT /citation=[2] FT conflict replace(264,"c") FT /citation=[2] XX SQ SEQUENCE 381 bp; 97 a; 78 c; 99 g; 107 t; tttctttata tactactgtt tttccttctg tactggcttt atcgaattct gcaacatgat 60 aggcagaact cctaagctta gtgagctggt tctaggtgaa actgctgaag cgcttagtct 120 gcattgcgac gaagcattag agaatttaag tgatgatgat gaggaggatc atcaagatag 180 acaggtgcac agagaaaggc cctatgcagt gtccgtgcca tgtaagcgct gtaggcaaac 240 tatcagcttc gtctgcgtct gtgatccaga agccataaga accttgaatc gactgctatc 300 cgcatcgctt tccctggtgt gcccggagtg ttgtaactga aaatggctga aggtacagac 360 cctttagatg actgtggggg g 381