ID BPV5L1 STANDARD; DNA; VRL; 285 bp. XX DE Bovine papillomavirus type 5 L1 protein gene, partial cds. XX AC U21863 XX DT 13-JUL-1995 XX OS Bovine papillomavirus type 5. OC Bovine papillomavirus type 5;Viruses; dsDNA viruses, no RNA stage; OC Papovaviridae;Papillomavirus. XX RN [1] RP 1 - 285 RA Chan,S.-Y., Delius,H., Halpern,A.L. and Bernard,H.U; RT "Analysis of genomic sequences of 95 papillomavirus types - uniting RT typing, phylogeny and taxonomy;" RL Unpublished. XX RN [2] RP 1 - 285 RA Chan,S.-Y; RT "Direct Submission;" RL Submitted (23-FEB-1995) Shih-Yen Chan, Institute of Molecular andCell RL Biology, National University of Singapore, Lower Kent RidgeRoad, RL Singapore, 0511, Republic of Singapore. XX XX Created by HIV database on 1-NOV-1995 from GenBank: U21863. XX XX BPV-5 was isolated from a ``rice grain'' fibropapilloma of the XX FT KEY Location/Qualifiers FT source 1..285 FT /organism="Bovine papillomavirus type 5" FT CDS <1..>285 FT /note="NCBI gi: 896377" FT /gene="L1" FT /codon_start=1 FT /product="L1 protein" FT /translation="YCRHVEEYKLAVILELCSVELTYETVAYLQTVNPSVLEKWEVGV FT NPPPATVLEDTYRYQESKAIKCIDQTAAAKKDKYENLSFWNIDLREKLSAD" XX SQ SEQUENCE 285 bp; 98 a; 52 c; 62 g; 73 t; tattgcaggc atgtagagga atataagcta gccgttattc tggagctatg tagtgtggag 60 ctgacctacg aaaccgttgc atatttgcag accgttaacc cttctgtctt agaaaaatgg 120 gaagtaggag tgaaccctcc cccagccact gtattagaag acacttatag atatcaggaa 180 tccaaggcta taaaatgcat agatcagacg gcagcagcta aaaaagataa atatgaaaat 240 cttagctttt ggaatattga tctcagagaa aaattatccg cagat 285