ID BPV3L1 STANDARD; DNA; VRL; 285 bp. XX DE Bovine papillomavirus type 3 L1 protein gene, partial cds. XX AC U21862 XX DT 13-JUL-1995 XX OS Bovine papillomavirus type 3. OC Bovine papillomavirus type 3;Viruses; dsDNA viruses, no RNA stage; OC Papovaviridae;Papillomavirus. XX RN [1] RP 1 - 285 RA Chan,S.-Y., Delius,H., Halpern,A.L. and Bernard,H.U; RT "Analysis of genomic sequences of 95 papillomavirus types - uniting RT typing, phylogeny and taxonomy;" RL Unpublished. XX RN [2] RP 1 - 285 RA Chan,S.-Y; RT "Direct Submission;" RL Submitted (23-FEB-1995) Shih-Yen Chan, Institute of Molecular andCell RL Biology, National University of Singapore, Lower Kent RidgeRoad, RL Singapore, 0511, Republic of Singapore. XX XX Created by HIV database on 1-NOV-1995 from GenBank: U21862. XX XX XX FT KEY Location/Qualifiers FT source 1..285 FT /organism="Bovine papillomavirus type 3" FT CDS <1..>285 FT /note="NCBI gi: 896375" FT /codon_start=1 FT /product="L1 protein" FT /translation="YLRHVEEWEVSLVLQLCIVDLTPEALAHINCMDPRIIESWNLGF FT IHAPNNIEDQYRYLQSIATRCPPKEDAAATEDPYAKYTFWDVDLTERFSMN" XX SQ SEQUENCE 285 bp; 92 a; 55 c; 60 g; 78 t; tatttaagac atgtagaaga atgggaagtg tccttagttc tgcaactgtg tatagtggac 60 ctaacaccag aggctttagc tcacattaat tgcatggatc ctcgaattat agagagctgg 120 aacttaggct ttatacatgc accgaataat atagaggatc aatacagata cctacagtca 180 attgcaacta gatgcccccc taaagaagat gctgctgcaa ctgaggaccc ttatgcaaag 240 tacacatttt gggatgtgga ccttacagaa cgattttcta tgaat 285